DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG14518

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:151 Identity:45/151 - (29%)
Similarity:86/151 - (56%) Gaps:7/151 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQINGYKPFLYNI 93
            :.||..|.:..|...:...|.|::|:|....|:....:|..::.:.|...|.::.|||||:||::
  Fly    26 KMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLHPVHDVIVKARLLKRANGYKPWLYSV 90

  Fly    94 TIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINS-RLPKTLPFPTGN 157
            :.|||||::. ::|.:.:..::..:..|.:||:|||   :.::::.:..:.| :||  .|.|||.
  Fly    91 SFDGCQFIRR-RNNALIRIVWELFKEYSTINHTCPY---VGLQQVKNFYLRSEKLP--TPIPTGE 149

  Fly   158 YMFQTYWIANEKYRVVTKIYF 178
            |:....|:.|:|.:..|.:||
  Fly   150 YLLMIDWVFNKKPQAATNVYF 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 27/76 (36%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 31/94 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.