DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33632

DIOPT Version :10

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:158 Identity:76/158 - (48%)
Similarity:123/158 - (77%) Gaps:1/158 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TQIYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKL-LNSLKVNFGLHQQING 85
            |::||.:||||.:|.::.||.:..|||:|:||||:|:|:|.::|:||: :..:||.|||::::||
  Fly    20 TEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGLYKRLNG 84

  Fly    86 YKPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKT 150
            |||||||:|:|||:|:|:...|.:|.|||:..::.||:||:||||||:::::::..:||.:|.:.
  Fly    85 YKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSINYKLTEI 149

  Fly   151 LPFPTGNYMFQTYWIANEKYRVVTKIYF 178
            ||||.|||..:.:|||.:..|.:|..||
  Fly   150 LPFPEGNYKLEVHWIAYDIDRAITTFYF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:461928 40/75 (53%)
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 41/80 (51%)

Return to query results.
Submit another query.