DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG13590

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:152 Identity:48/152 - (31%)
Similarity:84/152 - (55%) Gaps:7/152 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQINGYKPFLY 91
            :::.||..|.|..|....:.||.||:.:|....|:..:..::...::.|:|...::.|||||||:
  Fly    24 YLKMTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNINVTFVEPARNISVHFKTMKKANGYKPFLF 88

  Fly    92 NITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKTLPFPTG 156
            :.|.|.|:||:. ::..|||..:..|||:|.:||:|||      |.|...:...::...:|.|:|
  Fly    89 DYTFDACEFMRR-RNQPVAKIIWYMIRNVSTINHTCPY------EGLQMLSDFHKVDIPVPLPSG 146

  Fly   157 NYMFQTYWIANEKYRVVTKIYF 178
            :|:....|:.:.|.:..|.:||
  Fly   147 DYLLMVDWLFDGKTQFATNVYF 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 30/75 (40%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 33/93 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472466
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.