DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG13561

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:166 Identity:46/166 - (27%)
Similarity:79/166 - (47%) Gaps:23/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QIYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKL-LNSLKVNFGLHQQINGY 86
            |:....:|||.:|.|..::...:..|.|.:|.|....:|.|..:|:. ...:.:...|.::.:||
  Fly    18 QVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQLLKKASGY 82

  Fly    87 KPFLYNI-TIDGCQFMKNTKS---NVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRL 147
            ||||||| ..|.|::::....   |::...|    .|.:|:| .||...:|::|       :.|.
  Fly    83 KPFLYNICQSDVCEYLEKRNHPFINIILSSF----GNRTNVN-KCPIPPEIVLE-------HFRF 135

  Fly   148 P----KTLPFPTGNY-MFQTYWIANEKYRVVTKIYF 178
            |    ..:|.|.|:| :|.|:.....:...| |:||
  Fly   136 PVKVLDMMPLPFGDYGLFTTFTFHRSELAQV-KVYF 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 26/84 (31%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472464
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.