DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33919

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:148 Identity:42/148 - (28%)
Similarity:61/148 - (41%) Gaps:31/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EFTNFKCTSMAKDVADIEYCFLKSVNRT-YQYLSTRIKVLKLLNSLKVNFG------LHQQI--- 83
            :.||   |.:...:..|| |.   |||| ...:|..:|.:. .|...||..      ||..|   
  Fly    16 QLTN---TQLVYKLKKIE-CL---VNRTRVSNVSCHVKAIN-WNLAVVNMDCFMIVPLHNPIIRM 72

  Fly    84 --------NGYKPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTS 140
                    |.|||||.::.|..|:.::...........:...:..:|:|||||::..:|......
  Fly    73 QVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARDGFL 137

  Fly   141 ETINSRLPKTLPFPTGNY 158
            :|  |.||   |||.|.|
  Fly   138 DT--SLLP---PFPQGFY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 24/75 (32%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
43.940

Return to query results.
Submit another query.