DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33795

DIOPT Version :10

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:150 Identity:48/150 - (32%)
Similarity:79/150 - (52%) Gaps:5/150 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQINGYKPFLYNI 93
            :.||..|.|..:....|..|.||:|||.....:....:....|.:.:::...::.|||||:||..
  Fly    27 KLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTNDVVIDYRFLKRENGYKPWLYKK 91

  Fly    94 TIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKTLPFPTGNY 158
            .||||:|::. ..:::.|..|...:..||:||:||:..||::..:...|    ..|.:|:|:|.|
  Fly    92 NIDGCRFLRK-PYDMLTKMIYMVFKPFSNINHTCPFYGDILIRGMYLRT----EIKAMPYPSGKY 151

  Fly   159 MFQTYWIANEKYRVVTKIYF 178
            |.|..|...:|.:|||.|.:
  Fly   152 MLQINWSFYKKIQVVTNISY 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:461928 28/75 (37%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 28/80 (35%)

Return to query results.
Submit another query.