DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33725

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:159 Identity:46/159 - (28%)
Similarity:82/159 - (51%) Gaps:19/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQINGYKPFLYNI 93
            :||||.|.|..:.......|.||:|:|....|:....||...|::.|:..|.::.||:||:|.::
  Fly    28 KFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLHPANNIIVHVKLFKKANGFKPWLLDV 92

  Fly    94 TIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPY-------NHDIIMEKLTSETINSRLPKTL 151
            .:|.|:|:: |..:...:..:|..::.|.:||:|||       :..:..|||           .|
  Fly    93 KLDACRFVR-TNFHPFVRIIFDLFKDFSTINHTCPYVGLQVVKDFYLRPEKL-----------KL 145

  Fly   152 PFPTGNYMFQTYWIANEKYRVVTKIYFCH 180
            |||:|:|:....||.:::.:..|.:.|.:
  Fly   146 PFPSGDYLLSLIWIFDKRPQFDTNVSFVY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 25/82 (30%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 27/91 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.