DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33644

DIOPT Version :10

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster


Alignment Length:139 Identity:35/139 - (25%)
Similarity:58/139 - (41%) Gaps:20/139 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TNFKCTSMAKDVADIEYCFL--KSVNRTYQYLSTRIKVLKLLNSLK----VNFGLHQQINGYKPF 89
            |..:|...:.:......|.|  ||.|...:..|....:.|.:|.::    .:|...:.|..|.. 
  Fly     6 TQIECPIHSPEYVQNFSCRLHKKSPNSGSKSFSAEFSLRKEVNDVRGAYVFSFKQGKSIINYTA- 69

  Fly    90 LYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEK---LTSETINSRLPKTL 151
               :.||.||.:...:|.::.|...|.:|.:||...:||:    :|.|   :...|||   ||.:
  Fly    70 ---MEIDYCQALSALQSQILFKLIADELRRVSNFPLNCPF----VMNKRYYVDEFTIN---PKVI 124

  Fly   152 PFPTGNYMF 160
            |..|...:|
  Fly   125 PSYTPEMIF 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:461928 22/78 (28%)
CG33644NP_001027259.1 DUF1091 64..133 CDD:461928 23/79 (29%)

Return to query results.
Submit another query.