DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33630

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster


Alignment Length:164 Identity:37/164 - (22%)
Similarity:63/164 - (38%) Gaps:33/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HIEFTNFKCTSMAKDVADIE--YCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQI---NGY 86
            ::|::    ||..|.|..|:  :.|.:|     .|:..:|    .::..:.:|.||.|:   .|.
  Fly    26 YMEYS----TSPKKAVVAIKQIHVFGES-----NYMKAKI----YIHEDRSHFDLHVQLVHELGS 77

  Fly    87 KPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKTL 151
            ...:.||.:.    :|...||...:.|.  :|.|:.......||.:.:||.:..:.:........
  Fly    78 NHLIMNIKVR----VKPEGSNAFVQLFE--LRRINFCEFLSEYNTNPMMEMMFKKNVKLNDIIVC 136

  Fly   152 PFPTGNYMFQTYWIA---------NEKYRVVTKI 176
            |...|||......||         |..||...:|
  Fly   137 PVRVGNYSLLNSDIAENIHADGVQNGTYRFFAEI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 17/75 (23%)
CG33630NP_001027166.1 DM8 96..186 CDD:214778 17/77 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448179
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.