DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33723

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster


Alignment Length:156 Identity:80/156 - (51%)
Similarity:118/156 - (75%) Gaps:1/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QIYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKL-LNSLKVNFGLHQQINGY 86
            :|...:||||.||.|:.||.|:...|.|||:||||:|:||::.:.|| :...:|||||:::.|||
  Fly    21 EIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKLPITKARVNFGLYKRFNGY 85

  Fly    87 KPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKTL 151
            :|||||.|:|.|.|.::.|:|.|||||:|.|:..||||||||||:|||:||::::|:|..:.|.|
  Fly    86 RPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDIIVEKVSTDTVNHHVTKIL 150

  Fly   152 PFPTGNYMFQTYWIANEKYRVVTKIY 177
            |:|.|:||.:|:|:.|:.|..|.::|
  Fly   151 PYPEGDYMLETHWMLNDIYCGVIQVY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 44/75 (59%)
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 49/84 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472003
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.080

Return to query results.
Submit another query.