DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33771

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster


Alignment Length:119 Identity:26/119 - (21%)
Similarity:50/119 - (42%) Gaps:22/119 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TKTQIYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQIN 84
            |....|:...|.||..| :|.:..:::....:.:.|.::   ..:.:|..|.:.| ||       
  Fly    29 TGNSSYNPKYFKNFTIT-IANNTMNMDMHLNRPIQRGFK---AHVDILLRLANAK-NF------- 81

  Fly    85 GYKPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCP------YNHD 132
               ..:::...|.|....:.|:::...:|.|..:| ||..::||      |.||
  Fly    82 ---QSMFSQKSDVCAVTSSVKNSLFKSWFKDMSKN-SNFMYNCPVEVGHYYMHD 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 13/55 (24%)
CG33771NP_001027145.3 DM8 80..171 CDD:214778 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447899
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.