DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33758

DIOPT Version :10

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:155 Identity:40/155 - (25%)
Similarity:76/155 - (49%) Gaps:5/155 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IAFTKTQIYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQ 81
            :..|.|::  ..:|.:..|.:..:|..:...|.||:::|....:|.:.|:.:.::.:.:.....:
  Fly    10 LVLTSTEV--EAKFKSLHCAAFDQDFGEFLLCKLKAISRLRNSISVQYKLKQPVSKIFIRLEFFK 72

  Fly    82 QINGYKPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYN--HDIIMEKLTSETIN 144
            :.||::|||||.|.:.|.|:.. .:||:....|.::|.....|:|||:.  .:.::|....|...
  Fly    73 RANGWRPFLYNFTANLCDFLAR-NNNVIMGIGYAYLRPYLVKNYSCPFKVIENELLECKDFELDI 136

  Fly   145 SRLPKTLPFPTGNYMFQTYWIANEK 169
            :.|....|..||.|..|..:||..|
  Fly   137 NNLRNRFPIETGEYALQLTFIAKNK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:461928 25/77 (32%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:461928 25/86 (29%)

Return to query results.
Submit another query.