DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33928

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster


Alignment Length:154 Identity:69/154 - (44%)
Similarity:101/154 - (65%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKL-LNSLKVNFGLHQQINGYKPF 89
            |.|||||.|||||.|..:|.||||||:.||||:|||.::::.|: ::...||.|||::.||..||
  Fly    25 SRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTVNLGLHKRSNGLMPF 89

  Fly    90 LYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKTLPFP 154
            ..|.|.|||:.:.|. .|.:..:.:...:..||:||||||.||||::||.:..:|.:..|.:|.|
  Fly    90 NQNFTFDGCKMVANV-GNPMVLFLFALFKPYSNINHSCPYTHDIIVDKLPTHFVNQQFTKYVPLP 153

  Fly   155 TGNYMFQTYWIANEKYRVVTKIYF 178
            .|:|:|.:.|..|.|.|.:.:::|
  Fly   154 EGDYVFNSNWFTNGKNRAIVRVHF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 31/75 (41%)
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 36/84 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472000
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.