DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33648

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:155 Identity:66/155 - (42%)
Similarity:102/155 - (65%) Gaps:4/155 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLS--TRIKVLKLLNSLKVNFGLHQQINGYKP 88
            |.:||||.||:|........|.|.:|||||||:|:|  :|:.:|.|.|: .:|..|:::.|||||
  Fly    21 SIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNA-TINVALYKRYNGYKP 84

  Fly    89 FLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNL-NHSCPYNHDIIMEKLTSETINSRLPKTLP 152
            ||||:::|.|:|::..|||:|.||.:|.|...||: :.:||:|..|.::|||:..:|::|.:.||
  Fly    85 FLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVDKLTTNFLNNKLTQVLP 149

  Fly   153 FPTGNYMFQTYWIANEKYRVVTKIY 177
            .|.|:|:|...|.:...||....:|
  Fly   150 VPEGDYLFAFRWFSYNIYRSSVNVY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 36/76 (47%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 38/85 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472067
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.