DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33688

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster


Alignment Length:167 Identity:56/167 - (33%)
Similarity:87/167 - (52%) Gaps:27/167 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQI----- 83
            :::|:.|||.||....:.:...|.||:|:||||::|:           .:.||  ||||:     
  Fly    17 VFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYI-----------DIYVN--LHQQVVNNVT 68

  Fly    84 --------NGYKPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTS 140
                    ||||||..::|||.|:|:|:.:.:::.| .||..:|.||:||:|||...:|:..|.:
  Fly    69 VIKLMRHNNGYKPFFVDVTIDVCKFLKDPRQSIIKK-LYDIYKNNSNINHTCPYKDVVIVHHLWT 132

  Fly   141 ETINSRLPKTLPFPTGNYMFQTYWIANEKYRVVTKIY 177
            ..:.|...|.||...|:|...|.|......|....:|
  Fly   133 GNLESDFMKYLPLIDGDYAIYTEWSVYNVARAFIDVY 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 31/75 (41%)
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.