DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33767

DIOPT Version :10

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster


Alignment Length:93 Identity:21/93 - (22%)
Similarity:36/93 - (38%) Gaps:24/93 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RTYQYLSTRIKVLKLLNSLKVNFGLHQQINGYKPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRN 119
            |.:..|...|::||:...:.:            .|::.:.|.|..    .|||....||.:|...
  Fly     6 RHHYSLDISIEMLKVCTLVSI------------IFVHKLAITGAA----GKSNFSPTYFENFTLE 54

  Fly   120 ISNLNHSCPYNHDIIMEKLTSETINSRL 147
            |.        |:.:.|:..||:.|:..|
  Fly    55 IQ--------NNTLFMDMTTSKPIHRGL 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:461928 16/64 (25%)
CG33767NP_001027141.1 DM8 90..180 CDD:214778
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.