DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33796

DIOPT Version :10

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:152 Identity:47/152 - (30%)
Similarity:77/152 - (50%) Gaps:9/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQINGYKPFLYNI 93
            :.||..|.|..|....|..|.||::||.....:.....|....|:.|::...::.|||:|:|.|.
  Fly    28 KLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLYPTKSITVHYQTFKRENGYRPWLVNT 92

  Fly    94 TIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEK--LTSETINSRLPKTLPFPTG 156
            .||||:|::. ..:.:....::..||.:|:||:||...|:|:..  ||::.:.      ||.|||
  Fly    93 QIDGCRFLRK-PYDALGILLFNIYRNFTNINHTCPLQGDMIVRNMYLTTDVMR------LPLPTG 150

  Fly   157 NYMFQTYWIANEKYRVVTKIYF 178
            :|:....||...|.:..|.:.|
  Fly   151 DYLLAIDWIFYGKPQFATNVSF 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:461928 28/77 (36%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 29/86 (34%)

Return to query results.
Submit another query.