DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33654

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster


Alignment Length:153 Identity:74/153 - (48%)
Similarity:105/153 - (68%) Gaps:11/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQINGYKPFL 90
            |..||||.:|||..|...|.|||:::|.||:|:||           :||||.....:.|||:||:
  Fly    24 SKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYL-----------TLKVNLFKTPRFNGYRPFM 77

  Fly    91 YNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKTLPFPT 155
            :|||:|.|:|:|||.|..:|||||:|..:.||||||||:|||:|::|:..:.:|.|:...||||.
  Fly    78 FNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPIDFVNHRVTNILPFPE 142

  Fly   156 GNYMFQTYWIANEKYRVVTKIYF 178
            |:|:.:|:|||.|..|.:.|||:
  Fly   143 GDYLLETHWIAYEIDRAMVKIYY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 42/75 (56%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 46/86 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472001
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.