DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33689

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster


Alignment Length:156 Identity:58/156 - (37%)
Similarity:95/156 - (60%) Gaps:2/156 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKL-LNSLKVNFGLHQQINGYK 87
            |::|:.|||.||.|.....|..:.||:|:||||::|:...:.:.|| ::::.::|.|.:..:|||
  Fly    17 IHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHGYK 81

  Fly    88 PFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKTLP 152
            ||..:.|.|||:|::|.|..:: |.||...:..||:||:|||:||||::.|.:..|.|...|.:|
  Fly    82 PFFIDYTFDGCKFLRNQKHPII-KLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLKYIP 145

  Fly   153 FPTGNYMFQTYWIANEKYRVVTKIYF 178
            ...|:|...:.|..:...|....:||
  Fly   146 MINGDYAVYSNWSTDNIMRAYLNLYF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 33/75 (44%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 34/80 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.