DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33453

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:154 Identity:52/154 - (33%)
Similarity:87/154 - (56%) Gaps:12/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQINGYKPFLY 91
            :|:.||..|.|:.|..|...||.||:.:|....|:.....|...|::.:...:.::::||||||:
  Fly    26 NIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLHPTNNVSLRLKMVKRLSGYKPFLF 90

  Fly    92 NITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKTLPFPTG 156
            ::|||.|||::. :.|.|.|.||.||::.|.|||:|||...::.:..|:.     .|  :|.|:|
  Fly    91 DVTIDACQFLRK-RHNPVIKMFYSFIKDYSTLNHTCPYGLQVVSDYHTAV-----FP--VPLPSG 147

  Fly   157 NY--MFQTYWIANEKYRVVTKIYF 178
            :|  :....:.|.:::.|  .|||
  Fly   148 DYGVLLDFIFYAKKQFHV--NIYF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 32/77 (42%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 31/82 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472468
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.