DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33454

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:157 Identity:57/157 - (36%)
Similarity:88/157 - (56%) Gaps:15/157 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IYSH---IEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQING 85
            :||.   ::.||..|.|..|.:....||.||:.:||...|......|..:||:.|.|.:.::.||
  Fly    18 VYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHINATFLHPINSISVRFQMLKRANG 82

  Fly    86 YKPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKT 150
            |||||::||:|.|||::. .:|.|.|..|:.|::.||:||||||...::.:       ..|:...
  Fly    83 YKPFLFDITVDACQFLRK-PNNPVIKIVYNMIKDASNINHSCPYGTVVLND-------FHRISLP 139

  Fly   151 LPFPTGNYMFQTYWIANEKYRVVTKIY 177
            ||||:|:|:.:..::.|.|    ||.|
  Fly   140 LPFPSGDYLSRLDFLINGK----TKFY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 33/75 (44%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 34/83 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472462
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.