DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33463

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:151 Identity:76/151 - (50%)
Similarity:112/151 - (74%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKL-LNSLKVNFGLHQQINGYKPFLY 91
            :||.|..|.::.|:.::.|||:||||||||:|:|.::|:|:| :.:.|||..|.|:.||||||||
  Fly    25 LEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPVTNAKVNGALFQRHNGYKPFLY 89

  Fly    92 NITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKTLPFPTG 156
            |||:|.|:.:||.|.:.||.||:|..:..||:|||||:|||||::|||::::..|:...||||.|
  Fly    90 NITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDIILDKLTAKSVYHRMTNILPFPEG 154

  Fly   157 NYMFQTYWIANEKYRVVTKIY 177
            :||.|..|..:..|||:.|::
  Fly   155 DYMLQLNWFTSGIYRVIFKVF 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 43/75 (57%)
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 47/84 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472018
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.