DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33477

DIOPT Version :10

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:97 Identity:22/97 - (22%)
Similarity:41/97 - (42%) Gaps:20/97 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KVLKLLNSLKVNFGL-----HQQINGYKPFLYNI-TIDGCQFMKNTKSNVVAKYFYDFIRN--IS 121
            :|:||..:..:|..:     |:       .:|.| ...||:|:.|.   |:.|.|.:..:.  ::
  Fly    82 RVVKLAPAFTINITIKVLKTHR-------IMYKIENFKGCEFLNNP---VIFKMFGESYKTLVVN 136

  Fly   122 NLNHSCPYNHDIIMEKLTSETINSRLPKTLPF 153
            .....||...::..  |.::.|.|.:|...||
  Fly   137 GSYFKCPIKPNVYY--LKTDGIMSMIPSVHPF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:461928 17/73 (23%)
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 18/79 (23%)

Return to query results.
Submit another query.