DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and CG33483

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:165 Identity:75/165 - (45%)
Similarity:114/165 - (69%) Gaps:4/165 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RGYKQIN---RQYTIAFTKTQIYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVL 67
            |.:|.|:   |.|.|..||.:|.|.:||||.||||..|...|.|||.||||||:::|||.::.:.
  Fly    50 RTFKYISVKVRMYKIPVTKVKIASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLH 114

  Fly    68 KL-LNSLKVNFGLHQQINGYKPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNH 131
            |: :..:||||.|.::.|||||||||||:|.|:.::::|.|.:..:||...::.||:||:||::|
  Fly   115 KVPITKVKVNFSLLKRFNGYKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDH 179

  Fly   132 DIIMEKLTSETINSRLPKTLPFPTGNYMFQTYWIA 166
            |:|:|||.:..:|.::...:.||.|:|:|.:.|.|
  Fly   180 DLIVEKLPTNFMNQKVNGDIKFPHGDYLFHSDWYA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 34/75 (45%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 38/84 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472103
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.