DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33658 and K12H4.7

DIOPT Version :9

Sequence 1:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_498758.2 Gene:K12H4.7 / 176136 WormBaseID:WBGene00019682 Length:510 Species:Caenorhabditis elegans


Alignment Length:100 Identity:19/100 - (19%)
Similarity:34/100 - (34%) Gaps:30/100 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQI------------NGYKPFLYNITIDG------- 97
            ||.:.:..:::.::.......||..|.|.|.|            ..|.|::..:...|       
 Worm   241 SVTQGFNLVASLLQTSDGRKQLKTAFHLCQDIQMDDKSLKYFWETVYSPYMEVVQYSGDAAGSFA 305

  Fly    98 ---------CQFMKNTKSNVV--AKYFYDFIRNIS 121
                     |::..||||..:  .|...|:...:|
 Worm   306 TQLTISHAICRYHINTKSTPLQKLKQVNDYFNQVS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 10/55 (18%)
K12H4.7NP_498758.2 Peptidase_S28 65..499 CDD:253262 18/99 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.