DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33851 and HTR12

DIOPT Version :9

Sequence 1:NP_001027363.1 Gene:His3:CG33851 / 3772518 FlyBaseID:FBgn0053851 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001030927.1 Gene:HTR12 / 839104 AraportID:AT1G01370 Length:178 Species:Arabidopsis thaliana


Alignment Length:134 Identity:65/134 - (48%)
Similarity:85/134 - (63%) Gaps:8/134 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 67
            :|..|...:||.:.     ..|.:|::.| .|..||.:|||||||||:|||.:||.|.|||....
plant    47 QTNPTTSPATGTRR-----GAKRSRQAMP-RGSQKKSYRYRPGTVALKEIRHFQKQTNLLIPAAS 105

  Fly    68 FQRLVREIAQDFKTDL--RFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            |.|.||.|........  |:.:.|::|||||:|.||||||.|:.||||||:|||:|.||.:||||
plant   106 FIREVRSITHMLAPPQINRWTAEALVALQEAAEDYLVGLFSDSMLCAIHARRVTLMRKDFELARR 170

  Fly   131 IRGE 134
            :.|:
plant   171 LGGK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33851NP_001027363.1 PTZ00018 1..136 CDD:185400 65/134 (49%)
HTR12NP_001030927.1 H4 72..173 CDD:390056 57/100 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.