DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33851 and Cenpa

DIOPT Version :9

Sequence 1:NP_001027363.1 Gene:His3:CG33851 / 3772518 FlyBaseID:FBgn0053851 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001100181.1 Gene:Cenpa / 298850 RGDID:1563607 Length:159 Species:Rattus norvegicus


Alignment Length:150 Identity:69/150 - (46%)
Similarity:88/150 - (58%) Gaps:20/150 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RTKQTARKSTGGKAP---------RKQLATKAARKSAPATG--------GVKKPHRYRPGTVALR 50
            |...|.|:.....||         |:|..|...|.|:||.|        |.:..|| |...:.|:
  Rat     5 RKPGTPRRRPSSPAPGPSQPATDSRRQSRTPTRRPSSPAPGPSRRSSGVGPQALHR-RRRFLWLK 68

  Fly    51 EIRRYQKSTELLIRKLPFQRLVREIAQDFK--TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI 113
            ||:..||||:||.||.||..:||||...|.  .||.:|:.|::|||||:||:||.||||..|.::
  Rat    69 EIKNLQKSTDLLFRKKPFGLVVREICGKFSRGVDLYWQAQALLALQEAAEAFLVHLFEDAYLLSL 133

  Fly   114 HAKRVTIMPKDIQLARRIRG 133
            ||.|||:.|||:||||||||
  Rat   134 HAGRVTLFPKDVQLARRIRG 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33851NP_001027363.1 PTZ00018 1..136 CDD:185400 68/149 (46%)
CenpaNP_001100181.1 DUF4554 <5..73 CDD:291750 20/68 (29%)
Histone 29..152 CDD:278551 61/123 (50%)
H3 59..156 CDD:128705 54/95 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.