DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33851 and cnp1

DIOPT Version :9

Sequence 1:NP_001027363.1 Gene:His3:CG33851 / 3772518 FlyBaseID:FBgn0053851 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_596473.1 Gene:cnp1 / 2539658 PomBaseID:SPBC1105.17 Length:120 Species:Schizosaccharomyces pombe


Alignment Length:118 Identity:76/118 - (64%)
Similarity:94/118 - (79%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ARKSAPATGG--VKKPH--RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQD----FKTD 82
            |:||..|..|  :.:|.  ||||||.||||||:||:||:|||::|||.|:||||:.:    |.||
pombe     2 AKKSLMAEPGDPIPRPRKKRYRPGTTALREIRKYQRSTDLLIQRLPFSRIVREISSEFVANFSTD 66

  Fly    83 --LRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRG 133
              ||:||:|:..||||:||:||.||||||||||||||||||.:|:||||||||
pombe    67 VGLRWQSTALQCLQEAAEAFLVHLFEDTNLCAIHAKRVTIMQRDMQLARRIRG 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33851NP_001027363.1 PTZ00018 1..136 CDD:185400 76/118 (64%)
cnp1NP_596473.1 Histone 1..118 CDD:278551 73/115 (63%)
H4 19..119 CDD:304892 68/99 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.