DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33851 and AgaP_AGAP012196

DIOPT Version :9

Sequence 1:NP_001027363.1 Gene:His3:CG33851 / 3772518 FlyBaseID:FBgn0053851 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_320336.2 Gene:AgaP_AGAP012196 / 1280490 VectorBaseID:AGAP012196 Length:136 Species:Anopheles gambiae


Alignment Length:136 Identity:133/136 - (97%)
Similarity:135/136 - (99%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||
Mosquito     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||:||.|||||||||||||||||||||||||||||||||||||||
Mosquito    66 LPFQRLVREIAQDFKTDLRFQSAAVAALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            ||||||
Mosquito   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33851NP_001027363.1 PTZ00018 1..136 CDD:185400 131/134 (98%)
AgaP_AGAP012196XP_320336.2 PTZ00018 1..136 CDD:185400 131/134 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X183
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.