DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33860 and HTR11

DIOPT Version :9

Sequence 1:NP_001027378.1 Gene:His3:CG33860 / 3772517 FlyBaseID:FBgn0053860 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_201338.1 Gene:HTR11 / 836660 AraportID:AT5G65350 Length:139 Species:Arabidopsis thaliana


Alignment Length:136 Identity:126/136 - (92%)
Similarity:133/136 - (97%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||.||||||||||||.||||:|||||||||||||:||||||||:||:||||||:||||
plant     1 MARTKQTARISTGGKAPRKQLAPKAARQSAPATGGVKKPHRFRPGTVALRDIRKYQKSTEILIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            |||||||||||||||||||||||||.|||||:||||||||||||||||||||||||||:||||||
plant    66 LPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKEIQLARR 130

  Fly   131 IRGERA 136
            ||||||
plant   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33860NP_001027378.1 PTZ00018 1..136 CDD:185400 124/134 (93%)
HTR11NP_201338.1 PTZ00018 1..136 CDD:185400 124/134 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X183
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.