DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dls and CG34303

DIOPT Version :10

Sequence 1:NP_001368948.1 Gene:dls / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001356898.1 Gene:CG34303 / 5740723 FlyBaseID:FBgn0085332 Length:181 Species:Drosophila melanogaster


Alignment Length:190 Identity:49/190 - (25%)
Similarity:77/190 - (40%) Gaps:47/190 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLLTLPMIC-FC-----------HVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQ 61
            |.:.:..:| ||           ...|.:|.|.....:......|.|||::|.|..|::.|.||:
  Fly     2 FSVRVAFLCIFCFNIFVISKVHGSYKFNSLACEVMAPELGKMKLCEIKAIDRKHNMINLSAFLNK 66

  Fly    62 VPIVDARVTIQF---RRFDSGYKPFLYDLSYDGCKFMKTQKNVLVKT-FYRTFQRNTNINHTCPY 122
               ..:.|.|.|   :|...|:.||.||:..|.|:|.|.::...:.. .|...:..||:||||||
  Fly    67 ---TISEVEIHFKMVKRERGGWHPFFYDIRIDVCQFFKNRRGFFISNLIYSFIKPYTNVNHTCPY 128

  Fly   123 -------------DHDLIVDKLFTGNLEEEFGRFIIIPNGDYAIYTDWATNKISRASVKI 169
                         |.|.::.|             ..:.:|.|.:.|.|...|  .|::|:
  Fly   129 MEGTEMRLWNWSPDEDAVLAK-------------FPVDHGTYGLQTTWYVKK--EAALKV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlsNP_001368948.1 DUF1091 73..153 CDD:461928 25/96 (26%)
CG34303NP_001356898.1 DUF1091 73..157 CDD:461928 25/96 (26%)

Return to query results.
Submit another query.