DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dls and CG46388

DIOPT Version :10

Sequence 1:NP_001368948.1 Gene:dls / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001356964.1 Gene:CG46388 / 39877389 FlyBaseID:FBgn0286834 Length:192 Species:Drosophila melanogaster


Alignment Length:150 Identity:27/150 - (18%)
Similarity:48/150 - (32%) Gaps:57/150 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FPTCRIKAVNRTHKYISIYAKLNQVPIVDARVTIQFRRFDSGYKPFLYDLSYDGCKFMK-TQKNV 101
            |..|.:|...::.|.|:   ::|                         :|..|.|:..| |:...
  Fly    71 FGACEVKLCPKSQKKIT---RIN-------------------------NLRLDFCQLKKHTESRS 107

  Fly   102 LVKTFYRTFQRN-TNINHTCPYDHD------------------------LIVDKLFTGNLEEEFG 141
            ::..||...:|. .|..:.||:..:                        .:|.|::..|   |.|
  Fly   108 VLGMFYLALRRAVVNFPNKCPFKKNTTYGVNRFHFGWQDIPQYLPDTNYTLVGKIYANN---ELG 169

  Fly   142 RFIIIPNGDYAIYTDWATNK 161
            ..|.:..|.:.:..|.|..|
  Fly   170 LEIKVTGGYFEVANDSAYRK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlsNP_001368948.1 DUF1091 73..153 CDD:461928 18/105 (17%)
CG46388NP_001356964.1 DUF1091 87..158 CDD:461928 12/98 (12%)

Return to query results.
Submit another query.