DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dls and CG33721

DIOPT Version :10

Sequence 1:NP_001368948.1 Gene:dls / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster


Alignment Length:155 Identity:64/155 - (41%)
Similarity:93/155 - (60%) Gaps:5/155 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIVDARVTIQF-RRFDSGYKPFLYD 86
            |||..|...:..::||..|.||:||||:||||:.|.:.:|||.:|...:|. |||.| |.|....
  Fly    27 FTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEVPITNASAKLQISRRFRS-YMPITIA 90

  Fly    87 LSYDGCKFMKTQKNV---LVKTFYRTFQRNTNINHTCPYDHDLIVDKLFTGNLEEEFGRFIIIPN 148
            .|.|.||:|..:||:   :::.|....::.||.||.||||||||:|:|.:..|.|.|...:.:|.
  Fly    91 ASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYDHDLIIDRLPSKYLSEHFTNILPLPP 155

  Fly   149 GDYAIYTDWATNKISRASVKIYLKI 173
            |||:..:.|.:..|.||::.||..:
  Fly   156 GDYSFNSIWYSRNIERATISIYYTV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlsNP_001368948.1 DUF1091 73..153 CDD:461928 35/83 (42%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:461928 36/86 (42%)

Return to query results.
Submit another query.