DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33690 and CG33928

DIOPT Version :9

Sequence 1:NP_001368948.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster


Alignment Length:150 Identity:55/150 - (36%)
Similarity:93/150 - (62%) Gaps:0/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIVDARVTIQFRRFDSGYKPFLY 85
            :.|||:.|:|.:..|..|..|.:||.|||:||:|:..:|.::|:....|.:...:..:|..||..
  Fly    27 IEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYKIPVHHFTVNLGLHKRSNGLMPFNQ 91

  Fly    86 DLSYDGCKFMKTQKNVLVKTFYRTFQRNTNINHTCPYDHDLIVDKLFTGNLEEEFGRFIIIPNGD 150
            :.::||||.:....|.:|...:..|:..:||||:|||.||:|||||.|..:.::|.:::.:|.||
  Fly    92 NFTFDGCKMVANVGNPMVLFLFALFKPYSNINHSCPYTHDIIVDKLPTHFVNQQFTKYVPLPEGD 156

  Fly   151 YAIYTDWATNKISRASVKIY 170
            |...::|.||..:||.|:::
  Fly   157 YVFNSNWFTNGKNRAIVRVH 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33690NP_001368948.1 DUF1091 73..153 CDD:399471 30/79 (38%)
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 31/83 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472090
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.