DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33690 and CG33772

DIOPT Version :9

Sequence 1:NP_001368948.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027146.4 Gene:CG33772 / 3772205 FlyBaseID:FBgn0053772 Length:185 Species:Drosophila melanogaster


Alignment Length:174 Identity:44/174 - (25%)
Similarity:66/174 - (37%) Gaps:51/174 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LDFMSFPTCRIKAVNRTHKYISIY------------AKLNQVPIVDA----RVTIQFRRFDSG-- 79
            |:|:.|   |....|...||||:|            ..||....:.|    :.||..|...||  
  Fly    27 LNFLLF---RKIVANHNSKYISLYEAAISQDHTTINITLNLARNITADVWLKATIGQRVSKSGES 88

  Fly    80 YKP-FLYDLSYDGCKFMKTQKNV-LVKTFYRTFQRNTNINHTCPYDHDLIVDKLFTGNL------ 136
            |:. |.|:::.  |:.|...|.: |:..:.....|.:|:...||         |..||.      
  Fly    89 YRDVFTYNVNL--CQVMGRGKGISLINFWMNNILRQSNMPRNCP---------LREGNYYMRNIR 142

  Fly   137 --EEEFGRFIIIPNG----DYAIYT-DWATNKISRASVKIYLKI 173
              :|...||  |.:|    |.::|. ||  |.::......|:.|
  Fly   143 SEKETIPRF--IRSGSFRIDSSVYVRDW--NSVNLTETIFYVDI 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33690NP_001368948.1 DUF1091 73..153 CDD:399471 23/95 (24%)
CG33772NP_001027146.4 DUF1091 89..182 CDD:301369 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.