DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dls and CG33648

DIOPT Version :10

Sequence 1:NP_001368948.1 Gene:dls / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:155 Identity:61/155 - (39%)
Similarity:100/155 - (64%) Gaps:2/155 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIVDARVTIQFRRFDSGYKPFLY 85
            |.|||:.|||.:..::.:.:||||:||||:||||:.::|..:|:.:|.:.:...:..:|||||||
  Fly    23 VEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNATINVALYKRYNGYKPFLY 87

  Fly    86 DLSYDGCKFMKTQK-NVLVKTFYRTFQRNTNI-NHTCPYDHDLIVDKLFTGNLEEEFGRFIIIPN 148
            ::|.|.|:|::||| |::||..:......:|| :.|||::..:.||||.|..|..:..:.:.:|.
  Fly    88 NVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVDKLTTNFLNNKLTQVLPVPE 152

  Fly   149 GDYAIYTDWATNKISRASVKIYLKI 173
            |||.....|.:..|.|:||.:|:.|
  Fly   153 GDYLFAFRWFSYNIYRSSVNVYITI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlsNP_001368948.1 DUF1091 73..153 CDD:461928 32/81 (40%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:461928 32/85 (38%)

Return to query results.
Submit another query.