DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33690 and CG33798

DIOPT Version :9

Sequence 1:NP_001368948.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster


Alignment Length:172 Identity:67/172 - (38%)
Similarity:105/172 - (61%) Gaps:3/172 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKFLLTLPMICFCH--VTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIVDARV 69
            |.||:|:.:|...|  |..||..|.|.:.:|..|..||:|:||||:||||:...|.|.|:...:|
  Fly     5 VGFLVTIFLIRKVHSLVEITNFECESLDRNFSDFEYCRLKSVNRTYKYISLKVHLFQTPVNQIKV 69

  Fly    70 TIQFRRFDSGYKPFLYDLSYDGCKFMKTQ-KNVLVKTFYRTFQRNTNINHTCPYDHDLIVDKLFT 133
            .....:..:|||||||:::.|||||:|.| .|.:.|..:..|:..||:||:||||||:|::||..
  Fly    70 NTAIYKRLNGYKPFLYNVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPYDHDIIMEKLSA 134

  Fly   134 GNLEEEFGRFIIIPNGDYAIYTDWATNKISRASVKIYLKILN 175
            .::..:..:.:..|.|.|.:..:|....|:||.:::|:.:.|
  Fly   135 ESINFQITKILPFPEGKYMVKMNWFAYDINRAIIRLYITLTN 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33690NP_001368948.1 DUF1091 73..153 CDD:399471 33/80 (41%)
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 34/84 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472110
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.