DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33690 and CG33927

DIOPT Version :9

Sequence 1:NP_001368948.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:164 Identity:45/164 - (27%)
Similarity:74/164 - (45%) Gaps:19/164 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLVKFLLTLPMICFCHVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIVDARV 69
            |..:..|.|..|......|||..|.|.|..:::...||:||:.|....:|....:.:. |...||
  Fly    12 LFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLKT-ISKFRV 75

  Fly    70 TIQFRRFDSGYKPFLYDLSYDGCKFMKTQKNVLVKTFYRTFQRNTNINHTCPYDHDLIVDKLFTG 134
            ..|..:..:|:||:||::::|||:|::......|...:...:..:|:|.||||...:.:      
  Fly    76 HGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFSNLNFTCPYMGPVHI------ 134

  Fly   135 NLEEEFGRFII-------IPNGDYAIYTDWATNK 161
                 .|..||       :|.|:|.|...|..:|
  Fly   135 -----MGLHIIGEQIPVPLPTGEYLIQIKWYISK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33690NP_001368948.1 DUF1091 73..153 CDD:399471 22/86 (26%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.940

Return to query results.
Submit another query.