DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dls and CG33768

DIOPT Version :10

Sequence 1:NP_001368948.1 Gene:dls / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster


Alignment Length:163 Identity:39/163 - (23%)
Similarity:65/163 - (39%) Gaps:27/163 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKWLLVKFLLTLPMICFCHVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIV 65
            |.|.:.|..::.:.......||...:.|.. |..|  |.|..:.:||.|     |||.:..:..:
  Fly     1 MLKIVCVLMVIFVSQAVSSSVTLNRVQCEK-NAKF--FATLNVTSVNST-----IYADIELLQAL 57

  Fly    66 DA----RVTIQFRRFDSGYKPF--LYDLSYDGCKFMKTQKNVLVKTFYRTFQRNTNINHTCPYDH 124
            .|    .|.:|.|.  |..|.|  |.....|.|:.:.|.|:.|.:.:.::..:|:|....||   
  Fly    58 KAGFRGHVDVQLRL--SNAKKFQSLVQADTDYCELLSTLKDSLFRRWIKSVSKNSNFMENCP--- 117

  Fly   125 DLIVDKLFTGNLEEEFGRFIIIP----NGDYAI 153
             :.....:......|.|   ::|    :|||.:
  Fly   118 -VPAGHYYLKGWHVEMG---LVPSYLLSGDYLL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlsNP_001368948.1 DUF1091 73..153 CDD:461928 20/85 (24%)
CG33768NP_001027142.2 DM8 76..167 CDD:214778 17/78 (22%)

Return to query results.
Submit another query.