DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dls and CG33463

DIOPT Version :10

Sequence 1:NP_001368948.1 Gene:dls / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:175 Identity:61/175 - (34%)
Similarity:105/175 - (60%) Gaps:7/175 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKWLLVKFL-LTLPMICFCHVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPI 64
            ::.||.::.. .|..|:     .|.|:||.:.:.:|..|..|.:|:||||:||||:..||.|:|:
  Fly     9 LTLWLAMQLASKTTAML-----EFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPV 68

  Fly    65 VDARVTIQFRRFDSGYKPFLYDLSYDGCKFMKTQK-NVLVKTFYRTFQRNTNINHTCPYDHDLIV 128
            .:|:|.....:..:|||||||:::.|.||.:|..| :.:...|:.||:..:|:||:||::||:|:
  Fly    69 TNAKVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDIIL 133

  Fly   129 DKLFTGNLEEEFGRFIIIPNGDYAIYTDWATNKISRASVKIYLKI 173
            |||...::.......:..|.|||.:..:|.|:.|.|...|:::.:
  Fly   134 DKLTAKSVYHRMTNILPFPEGDYMLQLNWFTSGIYRVIFKVFVSL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlsNP_001368948.1 DUF1091 73..153 CDD:461928 30/80 (38%)
CG33463NP_995846.2 DUF1091 73..158 CDD:461928 31/84 (37%)

Return to query results.
Submit another query.