DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33690 and CG33467

DIOPT Version :9

Sequence 1:NP_001368948.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:189 Identity:49/189 - (25%)
Similarity:82/189 - (43%) Gaps:41/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LTLPMICFC-HVT-------FTNLNCSSYNLDFMSFPTCRIKAVNRTHKYIS-----IYAKLNQV 62
            |.|..|||. |:|       ||.:.|.. |...:...:|.:|.:|.....::     ||..:|  
  Fly     6 LVLLSICFIGHMTDSQLVYKFTKVECQG-NQARVKNVSCNVKPINWNTALVNLDCYLIYPLIN-- 67

  Fly    63 PIVDARVTIQFRRFDSGYKPFLYDLSYDGCKFMKTQKNVL--VKTFYRTFQRNTNINHTCPYDHD 125
            |.:  ||.:..:.:.:.|||||.|.::..|..:: :||.|  ....:..|||.||:. :|   | 
  Fly    68 PTI--RVQVFMKDYSNQYKPFLIDATFKLCDVVE-RKNFLPYAVMVWELFQRFTNVK-SC---H- 124

  Fly   126 LIVDKLFTGNLEEEFGRFII-----IPNGDYAI---YTDW-ATNKISRASVKIYLKILN 175
                  .:|.|....|....     .|:|.|.|   ::|. :||:.....||.:::.::
  Fly   125 ------ISGQLSARNGYLNSSYVPPFPHGQYQISVMFSDSNSTNREFVGIVKFFVQAMD 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33690NP_001368948.1 DUF1091 73..153 CDD:399471 23/86 (27%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 25/94 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.