DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dls and CG33467

DIOPT Version :10

Sequence 1:NP_001368948.1 Gene:dls / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:189 Identity:49/189 - (25%)
Similarity:82/189 - (43%) Gaps:41/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LTLPMICFC-HVT-------FTNLNCSSYNLDFMSFPTCRIKAVNRTHKYIS-----IYAKLNQV 62
            |.|..|||. |:|       ||.:.|.. |...:...:|.:|.:|.....::     ||..:|  
  Fly     6 LVLLSICFIGHMTDSQLVYKFTKVECQG-NQARVKNVSCNVKPINWNTALVNLDCYLIYPLIN-- 67

  Fly    63 PIVDARVTIQFRRFDSGYKPFLYDLSYDGCKFMKTQKNVL--VKTFYRTFQRNTNINHTCPYDHD 125
            |.:  ||.:..:.:.:.|||||.|.::..|..:: :||.|  ....:..|||.||:. :|   | 
  Fly    68 PTI--RVQVFMKDYSNQYKPFLIDATFKLCDVVE-RKNFLPYAVMVWELFQRFTNVK-SC---H- 124

  Fly   126 LIVDKLFTGNLEEEFGRFII-----IPNGDYAI---YTDW-ATNKISRASVKIYLKILN 175
                  .:|.|....|....     .|:|.|.|   ::|. :||:.....||.:::.::
  Fly   125 ------ISGQLSARNGYLNSSYVPPFPHGQYQISVMFSDSNSTNREFVGIVKFFVQAMD 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dlsNP_001368948.1 DUF1091 73..153 CDD:461928 23/86 (27%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:461928 25/94 (27%)

Return to query results.
Submit another query.