DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33690 and CG30050

DIOPT Version :9

Sequence 1:NP_001368948.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster


Alignment Length:113 Identity:24/113 - (21%)
Similarity:52/113 - (46%) Gaps:21/113 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HVTFTNLNCSSYNLDFMSFPTCR-IKAVNRT-------HKYISIYAKLNQVPIVDARVTIQFRRF 76
            ::....::|.. |.::.:...|| |...|||       .:.:|:::...:|.|.:|:..|     
  Fly    30 YIEMKQMDCVG-NPNYFANLYCRIIPPKNRTMEASVNIMQQLSVFSGSLRVSIPNAKKVI----- 88

  Fly    77 DSGYKPFLYDLSYDGCKFMKTQK-NVLVKTFYRTFQRNTNIN-HTCPY 122
                 ..::|:::|.||.::.:| .:|:.....|..:|:|.. ..||:
  Fly    89 -----TQIFDITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPF 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33690NP_001368948.1 DUF1091 73..153 CDD:399471 11/52 (21%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.