DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11889 and pkdc

DIOPT Version :9

Sequence 1:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:231 Identity:51/231 - (22%)
Similarity:84/231 - (36%) Gaps:60/231 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ERDSIMFEDLSLERYKVACRVKKLDLEHTYL-------VLEKLADFHAAGAALAQRQPGIFEKNY 189
            |...|:.|||.:..:.|         ..||:       .|..:|:|||.                
Zfish   106 EEQLIVLEDLDVAGFPV---------RKTYVNDAEIKACLSWIANFHAL---------------- 145

  Fly   190 DRGFFNKHVRGYEPIMKN-ILKALSRTLDLSPDLKERYQA-KIDRLIDNVMDYGERSTSVAPGDF 252
               |.:....|..||... .|:.....|:...|.|.:..| :||.:::|..             |
Zfish   146 ---FLDVTPEGLWPIGTYWHLETRPEELEAMSDQKLKAAAGEIDSILNNCR-------------F 194

  Fly   253 VTLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQ 317
            .|:.|||....|..|..|.    :....:|||:........|:.||..:.:.|....::...|:.
Zfish   195 KTIVHGDAKLANFCFSKDG----LQVASVDFQYVGGGCGMKDVIYFLGSCMDERECEKKAPGLLD 255

  Fly   318 FYFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFYA 353
            :||.:|..:||:     || ...|.::::|....:|
Zfish   256 YYFSELRKSLEK-----KV-DFAELEKEWRNMFAFA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 46/208 (22%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 45/205 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.