DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11889 and CG31370

DIOPT Version :9

Sequence 1:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:406 Identity:117/406 - (28%)
Similarity:187/406 - (46%) Gaps:43/406 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NAPAWLTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVMTRISVEYITKDSKDNQSATF 72
            |.|.||.|::|...||.:.|...|.:.||...|.:|.|:|||||:.|..|||||:  |...|.:.
  Fly    11 NVPEWLNEQFVTDVLRSHEKEPDLRVTKLDFTPGSAKGDNYASVIIRARVEYITQ--KGFFSKSL 73

  Fly    73 LLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVDRERDSIM 137
            ::||..       .:.....::..||.||.::||..|.|:: |.:|:.:|:|..:....|...:|
  Fly    74 IIKTVL-------EMFAGSALFKTEIGMYRKVLPEFARILR-ENNDTSRLYAECIYYSLEPSQVM 130

  Fly   138 -FEDLSLERYKVACRVKKLDLEHTYL--VLEKLADFHAAGAALAQRQPGIFEKNYDRGFFNKHVR 199
             ||||....|.:   |:...|.|..:  ...|||.|||....:...:|. |.|.:..|.....: 
  Fly   131 IFEDLGEMDYAM---VRDRVLTHGEICGAYSKLAKFHALSMKIINERPE-FVKEFKDGICLVDI- 190

  Fly   200 GYEPIMKNILKALSRTLDLSPDLKERYQAK--------IDRLIDNVMDYGERSTSVAPGDFVTLA 256
               |.|.:.:......|...|:| :||:..        ||||.|.:.:|   .|:..||.:| |.
  Fly   191 ---PYMSSGMGPFKDFLGRIPEL-DRYKTHFEKIEVHFIDRLRDIMKEY---QTNPQPGYYV-LC 247

  Fly   257 HGDIWTTNVMFQYDDE-GHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYF 320
            |||..|.|:|.:::.| |...:.:.:|:|.......|.||.|.....::...|:.....|:.:||
  Fly   248 HGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYF 312

  Fly   321 YKLVVALERVKYSGKVPSLFEF-QQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTSDEKG 384
            ..|...|.::.|.||:|....| ::.:|.|.:..:|.| .:.|..|....|.      .|::|..
  Fly   313 SVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLS-TYLPMSVGLSLET------ATNEETD 370

  Fly   385 VRLRDAVYQTEENLKK 400
            .:|:|.:.:.:..|.:
  Fly   371 DKLQDFIEECKSILAR 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 86/299 (29%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 86/299 (29%)
APH <202..320 CDD:279908 35/122 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.