DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11889 and CG14314

DIOPT Version :9

Sequence 1:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:408 Identity:91/408 - (22%)
Similarity:165/408 - (40%) Gaps:63/408 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VEKK----LRVY---FKN--DTLNLKKLTIKPATANGENYASVMTRISVEYITKDSKDNQSATFL 73
            ||.|    |.|:   ||:  ..:.:....:...:..|:||.:.:.||.:....:..|..|:   :
  Fly    20 VESKQILSLEVFQDIFKHVEPDVQIDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKWEQN---V 81

  Fly    74 LKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVDRER-DSIM 137
            :.....:...|.....:..::..|:..|..|:|.|.....::.:....:|.|.......| |.::
  Fly    82 ICKVMPESVVAREAYKSDKLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYSARHDLLI 146

  Fly   138 FEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQP------------GIF----- 185
            .|||....::::.|.|.|.||.|..||.::|..|....|....:|            |||     
  Fly   147 MEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIFCTANT 211

  Fly   186 --EKNYDRGFFNKHVRGYEPIMKNILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERSTSVA 248
              .:||           ||.:.||.::.:|..  |.||.|  |...:::..::...:| |...:|
  Fly   212 SWYRNY-----------YERLTKNAIQMVSEV--LPPDSK--YVLAMNKFAESSSFFG-RMVKLA 260

  Fly   249 PGD--FVTLAHGDIWTTNVMFQYDDEG-HPV-NAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRL 309
            ..:  ...:.|||.|..|.::.||.|. |.| ....:|||...::|.|:|:.........:.:|.
  Fly   261 STESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRD 325

  Fly   310 ERQTELVQFYFYKLVVALERVKYS--------GKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVY 366
            .:...|::.|..:|...|:.:..:        .|:..|  |.::.:|.|.:|:..:|...|....
  Fly   326 AQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKLQDL--FAEELKTYGRFALGLALDILPISTC 388

  Fly   367 NGKEEPSIEQFMTSDEKG 384
            :.::.|.: ....|||.|
  Fly   389 SSEDAPDM-YLDRSDELG 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 71/311 (23%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 71/308 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
33.010

Return to query results.
Submit another query.