DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11889 and CG6830

DIOPT Version :9

Sequence 1:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:432 Identity:115/432 - (26%)
Similarity:202/432 - (46%) Gaps:30/432 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PE-KTTHN--APAWLTEEYVEKKLRVYFKNDTLNLKKLT---IKPATANGENYASVMTRISVEYI 60
            || :..|:  .|.||.:...|:.|..    |.....|:.   :|||.|.|||||::|.|||::..
  Fly    36 PEPEVDHSDLVPKWLNQTQFEELLAA----DVDQFSKIVGFRVKPAMAPGENYATLMLRISIDVE 96

  Fly    61 TKDSKDNQSATFLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSR----- 120
            ..| |..:..:|::|... |......::.....:|.|...|.:|||::.::.|.:..|.:     
  Fly    97 LTD-KSTKLVSFMMKVPH-DTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRA 159

  Fly   121 -KLFAATVGVDRERDSIMFEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQ---RQ 181
             ||.|..  ..:..::::..||....:|...|::.|:||.|...|.:||.||||||.:.|   ..
  Fly   160 FKLDATK--EPKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPY 222

  Fly   182 PGIFEKNYDRGFFNKHVRGYEPIMKNILKALSRTLDLSPDL---KERYQAKIDRLIDNVMDYGER 243
            |.||.    .|....:.......|:.:|.:...:...:.|.   .|.|:.|:::.:..:.....:
  Fly   223 PDIFV----NGVMGNNKEAIIAFMEGMLASFRTSFMANLDKFKNGEEYREKLEKALAGLTMEFMK 283

  Fly   244 STSVAPGDFVTLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLR 308
            ...|.|.:|..|.|||.|..|::|:.:..|...:.:|:|||...:.|||:||.||..:|:..:.:
  Fly   284 LGIVDPNEFNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYK 348

  Fly   309 LERQTELVQFYFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPS 373
            |......::.|...||..|..:.::|:.|||.|..:.....|.:.:|.::...|.::.:..:..:
  Fly   349 LSHFDFFIRHYQEALVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSAT 413

  Fly   374 IEQFMTSDEKGVRLRDAVYQTEENLKKLHLTLPFLDQLGLLD 415
            .:.||:....||..|.::|..:...:.:...||:||..|.|:
  Fly   414 FDNFMSDSADGVSFRGSLYANKRCQEYIERILPWLDNRGFLE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 81/299 (27%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 81/299 (27%)
EcKinase 516..800 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.