DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11889 and CG33511

DIOPT Version :9

Sequence 1:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:361 Identity:75/361 - (20%)
Similarity:147/361 - (40%) Gaps:20/361 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KNDTLNLKKLTIKPATANGENYASVMTRISVEYITKDSKDNQSATFLLKTTFADKDPAAHLLINY 91
            |.|.:.|....:...:.:...|.....::.:|...|..|......:.:|:.....:|........
  Fly    21 KKDNVILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERK 85

  Fly    92 GIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVDRERDSIMFEDLSLERYKVACRVKKLD 156
            |::.:|..:|.||||::......:|:.  |.:.:      ..|.::.|||: :.|:.....:...
  Fly    86 GVFQKESALYSQILPKIQKYATKKLYP--KCYYS------RNDILVLEDLT-QDYRHLRANEYYT 141

  Fly   157 LEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRGFFNKHVRGYEPIMKNILKALSRTLDLSPD 221
            |:|..:|||.|::.|||..|..:::.....::|.......|:..........|||:......:|.
  Fly   142 LDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNNSWYITGLKAIVFLAARNPH 206

  Fly   222 LKE-RYQAKIDRLIDNVMDYGERSTSVAPGDFV--TLAHGDIWTTNVMFQYDDEGH--PVNAIFI 281
            .:. :.|..|...:.|::...|.  .|||...:  .|.|.|.|..|:::.::.|..  |.....:
  Fly   207 FQTMKAQNFIQDKLYNLLTKAEE--LVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIV 269

  Fly   282 DFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFYFYKLVVALERVKYSGKVPSLFEFQQQF 346
            |||.:.:.||.:|:.:.........:|.....|.::.|:..|...|:|:.....:.:...|:::.
  Fly   270 DFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKEC 334

  Fly   347 RTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTSDE 382
            :.....|:....:.||    ..|..|||...:.|:|
  Fly   335 QRTRLAALVIWALTEP----QTKMSPSISNRLRSEE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 62/292 (21%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 62/288 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.