DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11889 and CG2004

DIOPT Version :9

Sequence 1:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:308 Identity:76/308 - (24%)
Similarity:128/308 - (41%) Gaps:45/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PATANGENYASVMTRISVEYITKDSKDNQSATFL----LKTTFADKDPAAHLLINYGIYTREIDM 100
            |:...|:.|.|.:.||:: |..|::::.|....|    :.....|......|..:...:..||:.
  Fly    38 PSGKKGDAYLSRVFRITI-YGVKEAEEGQDEKQLEISVIVKAMPDNLHRRRLFRSVIFFRNEINF 101

  Fly   101 YEQILPRLADIVKNELHDSRKLFA------ATVGVDRERDSIMFEDLSLERYKVACRVKKLDLEH 159
            |.::||.:....|:.....:|.|.      |:: .|...|.|..||:....|:...|...:.||.
  Fly   102 YTKVLPAIEAFQKSRQPAPKKPFVEYPRCLASL-CDGVNDFIALEDVGPRGYRAPVRQDYISLED 165

  Fly   160 TYLVLEKLADFHAAGAALAQRQPGIFEKNYDRG-------FFNKHVR----GYEPIMKNILKALS 213
            ..|.:..|..||  |.|||..  .:..||:::.       ::.:|.|    |:..:.:|:  |..
  Fly   166 ALLTMRTLGRFH--GVALAFN--ALDSKNFEKAAGSLEETYYGEHTREWYTGFLLLAENV--ATD 224

  Fly   214 RTLDLSPDLKERYQAK-------IDRLIDNVMDYGERSTSVAPGDFVTLAHGDIWTTNVMFQYDD 271
            ....:.|:.|....|.       .|.||:.|....:.|         ...|||.||.|.:.:|::
  Fly   225 AVKQIYPNSKYETVATNFLQPPLFDDLINLVSTRSKLS---------VFGHGDCWTPNFLTKYNE 280

  Fly   272 EGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQFY 319
            .|.....|.||||.:..:|.|:||.:|..:...:.||.:...||::.|
  Fly   281 RGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAY 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 75/304 (25%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 75/304 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
33.010

Return to query results.
Submit another query.