DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11889 and H06H21.8

DIOPT Version :9

Sequence 1:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:309 Identity:70/309 - (22%)
Similarity:126/309 - (40%) Gaps:84/309 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 IMFEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRGFFNKHVRG 200
            |:.|:||.:.:.|. .:..|..|....::|.||..|:           ...|..|:.:....|.|
 Worm   129 IVAENLSEKVFAVE-HIPGLKHEQILRLMEALAGLHS-----------FLMKRDDKSYVESFVEG 181

  Fly   201 ------YEPIMKNILKALSRTLD-LSPDLKERYQAKIDRLIDNV---MDYGERSTSVA------P 249
                  :...|:|::...:.||: :||::...     || |.|:   .||..::.:.|      |
 Worm   182 AHGRETFSEGMQNMMFEEALTLENVSPEVFGN-----DR-IRNIKWSFDYSIKNKATADAISAFP 240

  Fly   250 GDFVTLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTE 314
            |   .:.|.|:..|||:::.|.....::|| ||:|.....|.|.|:....:..::..:| .:.|:
 Worm   241 G---IICHADLNVTNVLWKKDSAKDEISAI-IDYQMLFIGSIAFDIIRVLTLGLNREIR-RKMTQ 300

  Fly   315 LVQFYFYKLVVALERVKYSGKVP-SLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFM 378
            ....:::|.:..|.    :||.| |:.|...|:          |||:           |....|.
 Worm   301 NYLDHYHKTLTELS----NGKAPFSMEELLHQY----------SLIY-----------PFSSNFS 340

  Fly   379 TSDEKGVRLRDAVY---------QTEENLKKLHLTLPFLDQ-LGLLDEM 417
            ..   |:.|...:|         ..|||.|:|      :|: ||:::::
 Worm   341 LF---GIALYIKMYSDGTLGNPEDKEENCKEL------IDRALGIVEDI 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 48/211 (23%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 47/205 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.