DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11889 and E02C12.8

DIOPT Version :9

Sequence 1:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001379850.1 Gene:E02C12.8 / 179320 WormBaseID:WBGene00017093 Length:141 Species:Caenorhabditis elegans


Alignment Length:124 Identity:28/124 - (22%)
Similarity:37/124 - (29%) Gaps:46/124 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 WNSPAIDLQYFFST--SIHENLRLERQTELVQFYFYKLVVALERVKYSGKVPSLFEFQQQFRTKG 350
            |.....|||....|  :..||.|....::|                                 ||
 Worm    17 WEDVEKDLQQSLGTRATFGENKRATNISDL---------------------------------KG 48

  Fly   351 FYAVFASLIFEPTM--VYNGKEEPSIEQFMTSDE-------KGVRLRDAVYQTEENLKK 400
            |.:..|.|  ||..  :..|||.||......|.:       |.:...:....:||.|||
 Worm    49 FMSRIACL--EPDWQNIEEGKELPSKFALKISSQLALVALSKIMNFEEGAGFSEEKLKK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 9/45 (20%)
E02C12.8NP_001379850.1 PKc_like 3..>141 CDD:419665 28/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.